PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g30220.1.p
Common NameBRADI_4g30220, LOC100825541
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 323aa    MW: 34218.5 Da    PI: 6.7155
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g30220.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.6e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+ lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Bradi4g30220.1.p 14 KGPWTPEEDLMLVSYIQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding51.32.7e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Bradi4g30220.1.p  67 RGNFTDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129417.83961IPR017930Myb domain
SuperFamilySSF466894.4E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-131363IPR001005SANT/Myb domain
PfamPF002495.0E-161461IPR001005SANT/Myb domain
CDDcd001679.68E-121661No hitNo description
PROSITE profilePS5129424.72262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2465117IPR009057Homeodomain-like
SMARTSM007174.3E-1666114IPR001005SANT/Myb domain
PfamPF002495.4E-1567112IPR001005SANT/Myb domain
CDDcd001672.38E-1169111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDLMLVSYIQ EHGPGNWRAV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKMQ  120
QAAAGDGGAA TSSAGDTAGA AAAPAVPKGQ WERRLQTDIH TARQALRDAL SVEPSPAPAP  180
AKEELGTMPM PMSMPMPMPT PAPTTTTYAS SAENIARLLE GWMRPAASKG PEASGSASST  240
THPPQLQCSS WEGATSVSQS AGAAHTPEGS TETSHKTGGG GGAAPAFSML ESWLLDDGMG  300
HGDGEAGLMD DVVPLGDPSE FF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-26141164105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-26141164105C-Myb DNA-Binding Domain
1msf_C2e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519141e-164JF951914.1 Aegilops tauschii clone TaMYB31 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576526.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-105MYB06_ANTMA; Myb-related protein 306
TrEMBLI1IQ430.0I1IQ43_BRADI; Uncharacterized protein
STRINGBRADI4G30220.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.18e-92myb domain protein 94